PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G1229
Common NameSPL9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 280aa    MW: 30060.4 Da    PI: 9.3397
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G1229genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.91.2e-4280155176
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                  +CqvegC++dl++ak y++rhkvC +hska++v+v+gleqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+
  Gh_D01G1229  80 RCQVEGCKVDLTDAKAYYSRHKVCGMHSKAAKVIVAGLEQRFCQQCSRFHQLPEFDQRKRSCRRRLAGHNERRRKP 155
                  6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.0E-3574142IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.16378155IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.29E-4079159IPR004333Transcription factor, SBP-box
PfamPF031103.4E-3281154IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MEMGSGSLTD SGGSSSNSST ESLNGLKFGQ KIYFEDTSAG GTGGGTTMGT PPKSGIGSSS  60
SSGSGKKARG GVVQGGQPPR CQVEGCKVDL TDAKAYYSRH KVCGMHSKAA KVIVAGLEQR  120
FCQQCSRFHQ LPEFDQRKRS CRRRLAGHNE RRRKPPPGSL LSSRYSRLSS SIIESSRGGS  180
FIMDFTSHPR LSRRDVWPTS TSSEHVPGNQ YTGTGWLHPH PWQNNSENPP PNLYRQELPG  240
GTAVPSGGIP PEECFTGVVD SNCALSLFCQ INHGAPEIRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-32811541184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136153RKRSCRRRLAGHNERRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.103000.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223170.0KJ622317.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467002.10.0PREDICTED: squamosa promoter-binding-like protein 9
SwissprotA3C0571e-56SPL17_ORYSJ; Squamosa promoter-binding-like protein 17
TrEMBLA0A088DJZ50.0A0A088DJZ5_G
STRINGVIT_08s0007g06270.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21442775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-41squamosa promoter binding protein-like 9
Publications ? help Back to Top
  1. Zhang X, et al.
    Genomic organization, differential expression, and functional analysis of the SPL gene family in Gossypium hirsutum.
    Mol. Genet. Genomics, 2015. 290(1): p. 115-26
    [PMID:25159110]